DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AKR7A2

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_003680.2 Gene:AKR7A2 / 8574 HGNCID:389 Length:359 Species:Homo sapiens


Alignment Length:324 Identity:66/324 - (20%)
Similarity:114/324 - (35%) Gaps:85/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DREEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQ----------ALKDVPREAYYIATKVAR 107
            |.......|:..:..|...:|||..|..|:||.:||.          .:|        ||||...
Human    52 DAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVK--------IATKANP 108

  Fly   108 YE---LDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQ 169
            ::   |.|:::        |..::.||:.||..:||:..:|    ||.....:.||:...:...|
Human   109 WDGKSLKPDSV--------RSQLETSLKRLQCPQVDLFYLH----APDHGTPVEETLHACQRLHQ 161

  Fly   170 AGKARFIGVTAYD----VDVLKECAERG-------KGRIQVVLNYARYTLLDNTLLRH----MKA 219
            .||...:|::.|.    .::...|...|       :|............|.  ..|||    ..|
Human   162 EGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELF--PCLRHFGLRFYA 224

  Fly   220 FQEMGVGVVCA--------AAHSLG-LLSNAGPQS-----WHPGSPELLAVGKRGAEICQKRNVE 270
            :..:..|::..        ....:| ...|:..::     |.....|.:|:.::..:.....:..
Human   225 YNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAP 289

  Fly   271 LGKLA----MYYTMQLDGA--ATFLIGIPNRKLLRINLDAIFDG---------------LTSHE 313
            ....|    ||:..||.||  ...::|:.:.:.|..||.|..:|               |.:||
Human   290 SVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 61/298 (20%)
Aldo_ket_red 24..322 CDD:294321 66/324 (20%)
AKR7A2NP_003680.2 Aldo_ket_red 26..346 CDD:119408 63/315 (20%)
Tas 42..355 CDD:223739 66/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396894at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.