DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and YPL088W

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_015237.1 Gene:YPL088W / 856017 SGDID:S000006009 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:65/256 - (25%)
Similarity:113/256 - (44%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLGSTGLRVSKIALGGATL-SKLFSDDF--DREEGILTVQEAIRSGINYIDTAPFYGQGKSEELL 87
            :||::||::|.|.:|..:. ||.::|..  |:.:....::.....|:...|||.||..|.||.::
Yeast     8 RLGNSGLKISPIVIGCMSYGSKKWADWVIEDKTQIFKIMKHCYDKGLRTFDTADFYSNGLSERII 72

  Fly    88 GQALK--DVPREAYYIATKVARY-------------------ELDPNNMFDYTAAKARESVKRSL 131
            .:.|:  .:.||...|.||:  |                   |||.:|....:.......|:.|:
Yeast    73 KEFLEYYSIKRETVVIMTKI--YFPVDETLDLHHNFTLNEFEELDLSNQRGLSRKHIIAGVENSV 135

  Fly   132 ELLQLDRVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQAGKARFIGVT---AYDVDVLKECAERG 193
            :.|. ..:|:||:|.:|.    :..:.|.:..|.:.|:||..|:||.:   |.:...|:..|:: 
Yeast   136 KRLG-TYIDLLQIHRLDH----ETPMKEIMKALNDVVEAGHVRYIGASSMLATEFAELQFTADK- 194

  Fly   194 KGRIQVVLNYARYTLLDNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSWHPGSPELL 254
            .|..|.:.:.:.|.||.....|.:..|         |..|::|||      .|.|.:..:|
Yeast   195 YGWFQFISSQSYYNLLYREDERELIPF---------AKRHNIGLL------PWSPNARGML 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 65/256 (25%)
Aldo_ket_red 24..322 CDD:294321 65/256 (25%)
YPL088WNP_015237.1 AKR_EcYajO-like 5..332 CDD:381305 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.