DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AAD14

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_014068.1 Gene:AAD14 / 855385 SGDID:S000005275 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:92/352 - (26%)
Similarity:144/352 - (40%) Gaps:68/352 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RQLGST-GLRVSKIALGGATLSKL---FSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEE 85
            |.|..| |:|||.:.||||::...   |....::|:....:.....:|.|.||||..|...:||.
Yeast    19 RVLSKTAGIRVSPLILGGASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEI 83

  Fly    86 LLGQALKDVP-REAYYIATKVA----RYELDPNNMFDYTAAKARE---SVKRSLELLQLDRVDVL 142
            .:|:.:.... |:...||||..    :||:......:|.....|.   ||:.||..||.|.:|:|
Yeast    84 WIGEWMASRKLRDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDIL 148

  Fly   143 QVHDVDAAPSLDMVLNETIPVLEEYVQAGKARFIGVT---AYDVDVLKECA-ERGKGRIQV---- 199
            .:|..|...|::.|::.    |...||.||..::||:   |:.|......| ..||....|    
Yeast   149 YIHWWDYMSSIEEVMDS----LHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQGK 209

  Fly   200 --VLN-----------------YARYTLLDNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQS 245
              |||                 .|.:.::.....:..||.:|       ...:..||.:..|   
Yeast   210 WNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQSKKAMEE-------RKKNGEGLRTFVG--- 264

  Fly   246 WHPGSPEL-LAVGKRGAEICQKRNVE-LGKLAMYYTMQLDGAATFLIGIPNRKL--LRINLDAIF 306
             .|...|| :.:.:...:|.::...| :..:|:.|..........|||  .||:  |:.|::|:.
Yeast   265 -GPEQTELEVKISEALTKIAEEHGTESVTAIAIAYVRSKAKNVFPLIG--GRKIEHLKQNIEALS 326

  Fly   307 DGLTSHEQEVLQYLRENV-----FTKS 328
            ..||   .|.::||...|     |.||
Yeast   327 IKLT---PEQIEYLESIVPFDVGFPKS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 82/321 (26%)
Aldo_ket_red 24..322 CDD:294321 88/339 (26%)
AAD14NP_014068.1 AKR_AKR9A3_9B1-4 20..338 CDD:381373 86/337 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.