DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AAD15

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_014477.1 Gene:AAD15 / 853999 SGDID:S000005525 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:24/105 - (22%)
Similarity:38/105 - (36%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LGGATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYG---QGKSEELLGQALKDVPRE--- 97
            :||.......:.:..|:.|     |.|||         |.|   |..:|..:.:||..|..|   
Yeast    15 MGGGRFQSKKAMEERRKNG-----ECIRS---------FVGASEQTDAEIKISEALAKVAEEHGT 65

  Fly    98 AYYIATKVARYELDPNNMFDYTAAKARESVKRSLELLQLD 137
            ....|..:|.......|:|........|.:|.:::.|.:|
Yeast    66 ESVTAIAIAYVRSKAKNVFPSVEGGKIEDLKENIKALSID 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 24/105 (23%)
Aldo_ket_red 24..322 CDD:294321 24/105 (23%)
AAD15NP_014477.1 AKR_SF <1..115 CDD:412396 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.