DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and KCNAB2

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_016858110.1 Gene:KCNAB2 / 8514 HGNCID:6229 Length:435 Species:Homo sapiens


Alignment Length:369 Identity:85/369 - (23%)
Similarity:146/369 - (39%) Gaps:89/369 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLRVSKIALG-GATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEE 85
            |:||.||.:|||||.:.|| ..|.....:|:.  .|.::|:  |..:|||..|||..|..||:|.
Human    90 MKYRNLGKSGLRVSCLGLGTWVTFGGQITDEM--AEQLMTL--AYDNGINLFDTAEVYAAGKAEV 150

  Fly    86 LLGQALKDV--PREAYYIATKVARYELDPNNMFDYTAAKAR-----------ESVKRSLELLQLD 137
            :||..:|..  .|.:..|.||:            :...||.           |.:|.|||.|||:
Human   151 VLGNIIKKKGWRRSSLVITTKI------------FWGGKAETERGLSRKHIIEGLKASLERLQLE 203

  Fly   138 RVDVLQVHDVD-----------AAPSLDMVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC-- 189
            .|||:..:..|           ::.|...::.||:..:...:..|.|.:.|.:.:....:.|.  
Human   204 YVDVVFANRPDPNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYS 268

  Fly   190 AERGKGRIQVVLNYARYTLL--DNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSWHPGSPE 252
            ..|.......:...|.|.:.  :...::..:.|.::|||.:..:..:.|::|.    .:..|.|.
Human   269 VARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSG----KYDSGIPP 329

  Fly   253 LLAVGKRGAE-----------------------ICQKRNVELGKLAMYYTMQLDGAATFLIGIPN 294
            ......:|.:                       |.::....|.:||:.:.::.:|.::.|:|..|
Human   330 YSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASN 394

  Fly   295 RKLLRINLDAIFDGLTSHEQEVLQYLRENVF--------TKSYS 330
            ...|..|:.||         :||..|..::.        .|.||
Human   395 ADQLMENIGAI---------QVLPKLSSSIIHEIDSILGNKPYS 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 77/333 (23%)
Aldo_ket_red 24..322 CDD:294321 81/349 (23%)
KCNAB2XP_016858110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.