DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AAD4

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_010038.1 Gene:AAD4 / 851354 SGDID:S000002402 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:73/307 - (23%)
Similarity:124/307 - (40%) Gaps:60/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DREEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQALKDVP-REAYYIATKVA----RYELDP 112
            ::|:....:.....:|.|.||||..|...:||..:|:.:|... |:...||||..    :||:..
Yeast     5 NKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKLRDQIVIATKFTGDYKKYEVGG 69

  Fly   113 NNMFDYTAAKARE---SVKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQAGKAR 174
            ....:|.......   ||:.||..||.|.:|:|.||..|...|::.|::.    |...||.||..
Yeast    70 GKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDS----LHILVQQGKVL 130

  Fly   175 FIGVT---AYDVDVLKECA-ERGKGRIQV------VLN-----------------YARYTLLDNT 212
            ::||:   |:.|......| ..||....:      |||                 .|.:.::...
Yeast   131 YLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGG 195

  Fly   213 LLRHMKAFQEM---GVGVVCAAAHSLGLLSNAGPQSWHPGSPELLAVGKRGAEICQKRNVE-LGK 273
            ..:..||.:|.   |.|        |..:|....|     :.:.:.:.:..|::.::...| :..
Yeast   196 RFQSKKAMEERKKNGEG--------LRTVSGTSKQ-----TDKEVKISEALAKVAEEHGTESVTA 247

  Fly   274 LAMYYTMQLDGAATFLIGIPNRKL--LRINLDAIFDGLTSHEQEVLQ 318
            :|:.|..........|:|  .||:  |:.|::|:...||..:.|.|:
Yeast   248 IAIAYVRSKAKNVFPLVG--GRKIEHLKQNIEALSIKLTPEQIEYLE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 68/291 (23%)
Aldo_ket_red 24..322 CDD:294321 73/307 (24%)
AAD4NP_010038.1 AKR_AKR9A3_9B1-4 1..292 CDD:381373 72/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.