DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1c12

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_038805.2 Gene:Akr1c12 / 622402 MGIID:1351661 Length:323 Species:Mus musculus


Alignment Length:297 Identity:77/297 - (25%)
Similarity:118/297 - (39%) Gaps:72/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AIRSGINYIDTAPFYGQGKSEELLGQALKD------VPREAYYIATKV----ARYELDPNNMFDY 118
            |:..|..::|||..|   :.||.:|||::.      |.||..:|.||:    .|.||        
Mouse    41 ALDVGYRHVDTAYAY---QVEEEIGQAIQSKIKAGVVKREDLFITTKLWCGCFRPEL-------- 94

  Fly   119 TAAKARESVKRSLELLQLDRVDVLQVH--------------DVDAAPSLDMV-LNETIPVLEEYV 168
                .:.::::||:.||||.||:..:|              |.:....||.| ..:|...|||..
Mouse    95 ----VKPALEKSLKSLQLDYVDLYLIHYPVPMKPGDNESPLDENGKFLLDTVDFCDTWERLEECK 155

  Fly   169 QAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNYARYTLLDN--TLLRHMKAFQEMGVGVVCAA 231
            .||..:.|||:.::...|:....:...:.:.|.|.....|..|  .||.:.|:     ..:|..|
Mouse   156 DAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQSKLLDYCKS-----KDIVLVA 215

  Fly   232 AHSLGLLSNAGPQSW-HPGSPELL------AVGKRGAEICQKRNVELGKLAMYYTMQ---LDGAA 286
               .|.|.....:.| ...||.||      .|.||     .||:..|  :|:.|..|   :..|.
Mouse   216 ---YGALGTQRYKEWVDQNSPVLLNDPVLCDVAKR-----NKRSPAL--IALRYLFQRGIVPLAQ 270

  Fly   287 TFLIGIPNRKLLRINLDAIFDGLTSHEQEVLQYLREN 323
            :|     ....:|.||......|:..:.:.|..|.:|
Mouse   271 SF-----KENEMRENLQVFEFQLSPEDMKTLDGLNKN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 73/276 (26%)
Aldo_ket_red 24..322 CDD:294321 76/294 (26%)
Akr1c12NP_038805.2 Tas 6..297 CDD:223739 74/290 (26%)
ARA1 7..307 CDD:223729 77/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.