DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and kcnab1a

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_021323321.1 Gene:kcnab1a / 541540 ZFINID:ZDB-GENE-050327-79 Length:423 Species:Danio rerio


Alignment Length:322 Identity:82/322 - (25%)
Similarity:137/322 - (42%) Gaps:59/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLRVSKIALG-GATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEE 85
            |.||.||.:|||||.:.|| ..|.....|||.  .|.::|:  |..||:|..|||..|..||:|.
Zfish    88 MPYRNLGKSGLRVSCLGLGTWVTFGGQISDDV--AEQLMTI--AYESGVNLFDTAEVYAAGKAEV 148

  Fly    86 LLGQALKDV--PREAYYIATKVARYELDPNNMFDYTAAKAR-----------ESVKRSLELLQLD 137
            :||..:|..  .|.:..|.||:            |...||.           |.:|.||:.:|::
Zfish   149 ILGNIIKKKGWRRSSLVITTKL------------YWGGKAETERGLSRKHIIEGLKGSLQRMQME 201

  Fly   138 RVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC--AERGKGRIQVV 200
            .|||:..:    .|..:..:.|.:..:...:..|.:.:.|.:.:....:.|.  ..|....|..|
Zfish   202 YVDVVFAN----RPDSNTPMEEIVRAMTYVINQGMSMYWGTSRWTAMEIMEAYSVARQFNLIPPV 262

  Fly   201 LNYARYTLL--DNTLLRHMKAFQEMGVGVVCAAAHSLGLLS----NAGPQS---------W---- 246
            ...|.|.|.  :...::..:.:.::|||.:..:..:.|:::    |..|.|         |    
Zfish   263 CEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIITGKYENGIPDSSRASMKSYQWLKEK 327

  Fly   247 ---HPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINLDAI 305
               ..|..:...:.:.| .|.:|....|.:||:.:.::.:|.::.|:|..|.:.|..||.||
Zfish   328 IVSEDGRKQQAKLKELG-HIAEKLGCTLPQLAVAWCLRNEGVSSVLLGTSNAEQLTENLGAI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 80/319 (25%)
Aldo_ket_red 24..322 CDD:294321 81/320 (25%)
kcnab1aXP_021323321.1 Kv_beta 90..390 CDD:213602 81/320 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.