DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1c12l1

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001129216.1 Gene:Akr1c12l1 / 498790 RGDID:1559604 Length:323 Species:Rattus norvegicus


Alignment Length:323 Identity:81/323 - (25%)
Similarity:130/323 - (40%) Gaps:75/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ALGGATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQALKD------VPR 96
            |||..|   ...::..:.:.:..|..||.:|.::||||..|   :.||.:|||::.      |.|
  Rat    18 ALGFGT---SIPNEVPKSKSLEAVHLAIDAGYHHIDTASAY---QIEEEIGQAIQSKIKAGVVKR 76

  Fly    97 EAYYIATKV----ARYELDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQVH------------ 145
            |..:|.||:    .|.||            .:.::::||:.||||..|:..:|            
  Rat    77 EDMFITTKLWCTCFRPEL------------VKPALEKSLKNLQLDYADLYIMHYPVPMKSGDKYL 129

  Fly   146 --DVDAAPSLDMV-LNETIPVLEEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNYARYT 207
              |......||.| ..:|..:||:...||..:.|||:.::...|:....:...:.:.|.|.....
  Rat   130 PVDDKGKWLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECH 194

  Fly   208 LLDN--TLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSW-HPGSPELL------AVGKRGAEI 263
            |..|  .||.:.|:     ..:|..|   .|.|.....:.| ...||.||      .|.|:    
  Rat   195 LYMNQSKLLDYCKS-----KDIVLVA---YGALGTQRYKEWVDQNSPVLLDDPVLCDVAKK---- 247

  Fly   264 CQKRNVELGKLAMYYTMQLDG---AATFLIGIPNRKLLRINLDAIFDGLTSHEQEVLQYLREN 323
             .||:..|  :|:.|.:|.:.   |.:|     ....:|.||......|:..:.:.|..|.:|
  Rat   248 -NKRSPAL--IALRYLVQREVVPLAQSF-----KENEMRENLQVFEFQLSPEDMKTLDGLNKN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 77/302 (25%)
Aldo_ket_red 24..322 CDD:294321 80/320 (25%)
Akr1c12l1NP_001129216.1 ARA1 8..305 CDD:223729 81/323 (25%)
Tas 16..297 CDD:223739 78/316 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.