DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AKR1B15

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:255 Identity:58/255 - (22%)
Similarity:104/255 - (40%) Gaps:61/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGIN----YIDTAPFYGQGKSEELLGQAL------KDVPREAYYIATKVARYELDPNNM 115
            |:||::..|:    :||.|.||   :::..:|:|:      |.|.||..:|.:||.     |.  
Human    56 VKEAVKVAIDAEYRHIDCAYFY---ENQHEVGEAIQEKIQEKAVMREDLFIVSKVW-----PT-- 110

  Fly   116 FDYTAAKARESVKRSLELLQLDRVDVLQVH-------DVDAAPSLD---MVLN-----ETIPVLE 165
             .:.....|::.:::|:.|:|..:||..:|       ..|..|..|   |:..     :....:|
Human   111 -FFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLDAWEAME 174

  Fly   166 EYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTLLRHMKAFQEMGV--- 225
            |.|..|..:.:||:.::           ..:|:.:||.  .:|..:.|.:..|....||..:   
Human   175 ELVDEGLVKALGVSNFN-----------HFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYC 228

  Fly   226 ---GVVCAAAHSLGLLSNAGPQSW-HPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQ 281
               |:...|...||    :..:.| .|..|.||...|. .||..|......::.:.:.:|
Human   229 HSKGITVTAYSPLG----SPDRPWAKPEDPSLLEDPKI-KEIAAKHKKTTAQVLIRFHIQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 58/255 (23%)
Aldo_ket_red 24..322 CDD:294321 58/255 (23%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 58/255 (23%)
Tas 57..317 CDD:223739 57/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.