DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and CG10638

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster


Alignment Length:339 Identity:81/339 - (23%)
Similarity:122/339 - (35%) Gaps:115/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQALKD------VPREAYYIATKVARYELDPNN 114
            ||...|:.||..|..:||||.||   ::|..:|:|::|      |.||..::.||:.....||..
  Fly    29 EGEAAVKHAIDVGYRHIDTAYFY---QNEAEVGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPER 90

  Fly   115 MFDYTAAKARESV-KRSLELLQLDRV-------------------------DVLQVHDVDAAPSL 153
            :         |.: ::.|....||.:                         ||||:.|||..   
  Fly    91 V---------EGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYL--- 143

  Fly   154 DMVLNETIPVLEEYVQAGKARFIGVTAYDVD----VLKECAERGKGRIQVVLNYARYTLLDNTLL 214
                 :|...:|:.|:.|..|.|||:.::.:    ||..|      .|:.|.|....:       
  Fly   144 -----DTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANC------EIKPVTNQVECS------- 190

  Fly   215 RHMKAFQEMGVGVVCAAAHSLGL-----LSNAGPQSWHPG---SPELLAV----GKRGAEICQKR 267
               .|..:..:...| ..:.:.|     |....|....|.   |||:..:    ||...:|..:.
  Fly   191 ---PALNQKALTAFC-KKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRY 251

  Fly   268 NVELGKLAMYYTMQLDGAATFLIGIP---NRKLLRINLDAIFD-GLTSHEQEVLQYLRENVFTKS 328
            .|.||                :|.||   |...:..|.| ||| .||:.|..||.         .
  Fly   252 LVGLG----------------VIPIPKSSNTNRISENFD-IFDFELTAEEMAVLD---------G 290

  Fly   329 YSWGSTLSTVNMFK 342
            |..|..:..:|:.|
  Fly   291 YHTGERVVPLNLIK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 68/298 (23%)
Aldo_ket_red 24..322 CDD:294321 77/317 (24%)
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 79/335 (24%)
Tas 5..297 CDD:223739 79/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.