DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1B

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster


Alignment Length:318 Identity:68/318 - (21%)
Similarity:132/318 - (41%) Gaps:71/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IALGGATLSKLFSDDFDREEGILT--VQEAIRSGINYIDTAPFYGQGKSEELLGQALKD------ 93
            :.|.|..:..:....|:..:|.:|  |:.||.:|..:||.|..|   ::|:.:|..::.      
  Fly    41 VCLDGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVY---QNEDEVGDGVEAKIKEGV 102

  Fly    94 VPREAYYIATKVARYELDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQVH-------DVDAAP 151
            |.||..:|.:|:.       |.| :.....:.:::.:|..|:|..:|:..:|       ..|..|
  Fly   103 VKREDLFITSKLW-------NTF-HRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFP 159

  Fly   152 S----------LDMVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNYARY 206
            :          :|.|  :|...:|:.|:.|..:.|||:.::           :.:|:.||..|..
  Fly   160 TDKDGKTLYSPVDYV--DTWKAMEKLVEEGLVKSIGVSNFN-----------RRQIERVLEVATI 211

  Fly   207 TLLDNTLLRHMKAFQEMGV------GVVCAAAHSLGLLSNAGPQSW-HPGSPELLAVGKRGAEIC 264
            ..:.|.:..|....|:..:      .:...|...||    :..:.| ..|.|.:|...|. .||.
  Fly   212 PPVTNQIECHPYLTQKKLIDFCKSKDITITAYSPLG----SPNRPWAKAGDPVILEEAKI-KEIA 271

  Fly   265 QKRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINLDA---IFD-GLTSHEQEVLQ 318
            .|:....|::.:.|.:|...     |.|| :.:.:..:::   :|| .||..|.|:::
  Fly   272 AKKKKTPGQILIRYQVQRAN-----IVIP-KSVTKDRIESNFQVFDFELTPEEIEIIE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 62/298 (21%)
Aldo_ket_red 24..322 CDD:294321 68/318 (21%)
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 65/309 (21%)
Tas 45..>248 CDD:223739 47/230 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.