DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1c15

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:331 Identity:81/331 - (24%)
Similarity:129/331 - (38%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LGGATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQALKD------VPRE 97
            ||..|.:   |.:..:.:.....:.||..|..:||.|.||   ::||.:||||:|      |.||
  Rat    20 LGFGTFA---SKEIPKSKAAEATKVAIDVGFRHIDAAYFY---QNEEEVGQALRDKMADGTVKRE 78

  Fly    98 AYYIATKV----ARYELDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQVH------------- 145
            ..:..||:    .|.||            .|:.::|||:.|.||.||:..:|             
  Rat    79 DLFYTTKIWITFLRPEL------------VRQCLERSLKKLGLDYVDLCIIHIPIAMKPGEELLP 131

  Fly   146 -DVDAAPSLDMV-LNETIPVLEEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNYARYT- 207
             |.:.....|.| :.:|...||:...||.::.|||:.::           ..:::::||..|.. 
  Rat   132 KDANGKFIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFN-----------HKQLELILNKPRLKY 185

  Fly   208 ------------LLDNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSWHPG-------SPEL 253
                        |..:.||...|:     ..:|..|..:||   :....||...       .|.|
  Rat   186 KPTCNQVECHPYLNQSKLLEFCKS-----KDIVLVAYSALG---SHRDSSWVSSDSPYLLEDPVL 242

  Fly   254 LAVGKRGAEICQKRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINLDAIFD-GLTSHEQEVL 317
            :.:.|       |.|...|::|:.|  ||......|....|.|.::.|.. :|| .||..:.:.:
  Rat   243 MTIAK-------KHNQTPGQVALRY--QLQRGVVVLAKSFNEKRIKENFQ-VFDFELTPEDMKTI 297

  Fly   318 QYLREN 323
            ..|..|
  Rat   298 DSLNRN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 75/309 (24%)
Aldo_ket_red 24..322 CDD:294321 80/328 (24%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 81/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.