DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Kcnab2

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_017448703.1 Gene:Kcnab2 / 29738 RGDID:61828 Length:383 Species:Rattus norvegicus


Alignment Length:370 Identity:86/370 - (23%)
Similarity:146/370 - (39%) Gaps:94/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YRQLGSTGLRVSKIALG-GATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEELL 87
            ||.||.:|||||.:.|| ..|.....:|:.  .|.::|:  |..:|||..|||..|..||:|.:|
  Rat    39 YRNLGKSGLRVSCLGLGTWVTFGGQITDEM--AEHLMTL--AYDNGINLFDTAEVYAAGKAEVVL 99

  Fly    88 GQALKDV--PREAYYIATKVARYELDPNNMFDYTAAKAR-----------ESVKRSLELLQLDRV 139
            |..:|..  .|.:..|.||:            :...||.           |.:|.|||.|||:.|
  Rat   100 GNIIKKKGWRRSSLVITTKI------------FWGGKAETERGLSRKHIIEGLKASLERLQLEYV 152

  Fly   140 DVLQVHDVDAAPSLDM--------------VLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC- 189
            ||:..:..|  |:..|              ::.||:..:...:..|.|.:.|.:.:....:.|. 
  Rat   153 DVVFANRPD--PNTPMEAGDPFSSFKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAY 215

  Fly   190 -AERGKGRIQVVLNYARYTLL--DNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSWHPGSP 251
             ..|....|..:...|.|.:.  :...::..:.|.::|||.:..:..:.|::|.    .:..|.|
  Rat   216 SVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSG----KYDSGIP 276

  Fly   252 ELLAVGKRGAE-----------------------ICQKRNVELGKLAMYYTMQLDGAATFLIGIP 293
            .......:|.:                       |.::....|.:||:.:.::.:|.::.|:|..
  Rat   277 PYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGAS 341

  Fly   294 NRKLLRINLDAIFDGLTSHEQEVLQYLRENVF--------TKSYS 330
            |.:.|..|:.||         :||..|..::.        .|.||
  Rat   342 NAEQLMENIGAI---------QVLPKLSSSIVHEIDSILGNKPYS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 78/334 (23%)
Aldo_ket_red 24..322 CDD:294321 83/352 (24%)
Kcnab2XP_017448703.1 Aldo_ket_red_shaker 38..363 CDD:381367 83/354 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5200
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.