DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1b10

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001013102.1 Gene:Akr1b10 / 296972 RGDID:1308277 Length:316 Species:Rattus norvegicus


Alignment Length:296 Identity:68/296 - (22%)
Similarity:121/296 - (40%) Gaps:68/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGINYIDTAPFYGQGKSEELLGQAL------KDVPREAYYIATKVARYELDPNNMFDYT 119
            |:.||.:|..:.|.|..| |.:||  :|:|:      |.|.||..:|.:|     |.| ..|:.:
  Rat    32 VKAAIDAGYRHFDCAYVY-QNESE--VGEAIQEKIKEKAVRREDLFIVSK-----LWP-TFFEKS 87

  Fly   120 AAKARESVKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIPV-------------------LE 165
            ..|  ::.:::|..|:||.:|:..:|......|.::.|    |.                   :|
  Rat    88 LVK--KAFQKTLLDLKLDYLDLYLIHWPQGFQSGNVFL----PTDDKGNVLTSKYTFLDAWEGME 146

  Fly   166 EYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTLLRHMKAFQEMGV--- 225
            |.|..|..:.:||:.::           ..:|:.:||.  .::..:.|.:..|....||..:   
  Rat   147 ELVDQGLVKALGVSNFN-----------HFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYC 200

  Fly   226 ---GVVCAAAHSLGLLSNAGPQSWHPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAAT 287
               |:|..|...||   :....|..|..|.||.:.|. .||..|......::.:.:.::.:.|..
  Rat   201 HSKGIVVTAYSPLG---SPDRPSAKPEDPVLLEIPKI-KEIASKHKKTAAQVLIRFHIERNVAVI 261

  Fly   288 FLIGIPNRKLLRINLDAIFDGLTSHEQ--EVLQYLR 321
            .....|:|  ::.|:. :||...|.|.  .:|.:.|
  Rat   262 PKSVTPSR--IQENIQ-VFDFQLSEEDMAAILSFNR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 62/275 (23%)
Aldo_ket_red 24..322 CDD:294321 68/296 (23%)
Akr1b10NP_001013102.1 AKR_AKR1B1-19 10..316 CDD:381333 68/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.