DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and C35D10.6

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_498011.1 Gene:C35D10.6 / 175645 WormBaseID:WBGene00016443 Length:287 Species:Caenorhabditis elegans


Alignment Length:279 Identity:65/279 - (23%)
Similarity:116/279 - (41%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLRVSKIALGGATLSKLFSDDFDREEGIL--TVQEAIRSGINYIDTAPFYGQGKSE 84
            ||:|:.....:.:  |.:|...:.|         |.||  .:....:.|..:||||..|   .:|
 Worm     1 MEHREYVKNNMPL--IGIGTWQVQK---------EEILRQVIDAGFKEGYRFIDTAQVY---NNE 51

  Fly    85 ELLGQALK------DVPREAYYIATKVARYELDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQ 143
            ..:|:.|:      .:.||..:|.:|:|     |:|.   ...|||||::.||..|:::.:|:|.
 Worm    52 AKIGRILEKLLPANGLKREDIWITSKLA-----PSNA---GVKKARESIEESLSNLKVEYLDLLL 108

  Fly   144 VHDVDAA-----PSLDMVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY 203
            :|...::     |:...:..|:..|:.|.:..||.|.:||:.:::..|:|.  :....:...:|.
 Worm   109 IHWPGSSLKSENPANKKLRVESWNVMCEMMAEGKLRSVGVSNFEICHLEEL--KKDSNVVPAVNQ 171

  Fly   204 ARY-------TLL----DNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSWHPGSPELLAVG 257
            ..|       .|:    :|.:  |.:|:..:|                 .|......|.|.|.  
 Worm   172 VEYHPHFHQDDLVKYCNENNI--HFQAYSSLG-----------------SPTYRKQLSEEPLI-- 215

  Fly   258 KRGAEICQKRNVELGKLAM 276
               .|:.||.|||:..|.:
 Worm   216 ---KELAQKYNVEIPVLLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 65/279 (23%)
Aldo_ket_red 24..322 CDD:294321 63/277 (23%)
C35D10.6NP_498011.1 AKR_DrGR-like 11..273 CDD:381362 62/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2788
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.