DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1c3

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_612519.1 Gene:Akr1c3 / 171516 RGDID:708428 Length:323 Species:Rattus norvegicus


Alignment Length:366 Identity:91/366 - (24%)
Similarity:145/366 - (39%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KVRRMEYRQLGSTGLRVSKIALGG-ATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQG 81
            |:::||.    :.|..:..:..|. ||...|      |::.:.:.:.||..|..:||.:..|   
  Rat     4 KIQKMEL----NDGHSIPVLGFGTYATEENL------RKKSMESTKIAIDVGFRHIDCSHLY--- 55

  Fly    82 KSEELLGQALKD------VPREAYYIATKV----ARYELDPNNMFDYTAAKARESVKRSLELLQL 136
            ::||.:|||:..      |.||..:..:|:    .|.||            .|.|::.||..|.|
  Rat    56 QNEEEIGQAIVSKIEDGTVKREDIFYTSKLWSTSHRPEL------------VRPSLENSLRKLNL 108

  Fly   137 DRVDVLQVH-DVDAAPS-------------LDMV-LNETIPVLEEYVQAGKARFIGVTAYDVDVL 186
            |.||:..:| .|...|.             ||.| |.:|...:|:...||.|:.|||:.::...|
  Rat   109 DYVDLYLIHFPVSLKPGDELLPQDEHGNLILDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQL 173

  Fly   187 KECAERGKGRIQVVLNYARYTLLDNTLLRHMKAFQEMGVGVVCAAAHSLG--------------L 237
            ::...:...:.:.|.|.....|..|.  ..:.|:.:|. .:|..|..:||              |
  Rat   174 EKILNKPGLKHRPVCNQVECHLYLNQ--SKLLAYCKMN-DIVLVAYGALGTQRYKYCINEDTPVL 235

  Fly   238 LSNAGPQSWHPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINL 302
            |.:          |.|..:.|:     .||...|  :|:.|  ||:.....|:...|.:.:|.||
  Rat   236 LDD----------PILCTMAKK-----YKRTPAL--IALRY--QLERGIVTLVKSFNEERIRENL 281

  Fly   303 DAIFD-GLTSHEQEVLQYLRENVFTKSYSWGSTLSTVNMFK 342
            . :|| .|.|.:.|:|..|..|:         .....||||
  Rat   282 Q-VFDFQLASDDMEILDNLDRNL---------RYFPANMFK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 78/321 (24%)
Aldo_ket_red 24..322 CDD:294321 83/338 (25%)
Akr1c3NP_612519.1 AKR_AKR1C1-35 6..308 CDD:381334 86/358 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.