DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr7a2

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_599234.1 Gene:Akr7a2 / 171445 RGDID:620311 Length:338 Species:Rattus norvegicus


Alignment Length:315 Identity:72/315 - (22%)
Similarity:116/315 - (36%) Gaps:92/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DREEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQ----------ALKDVPREAYYIATKVAR 107
            |......||:..:..|:|.:|||..|..|:||.:||.          .:|        ||||...
  Rat    31 DASASAATVRAFLERGLNELDTAFMYCDGQSESILGSLGLGLGSGDCTVK--------IATKANP 87

  Fly   108 YE---LDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQ 169
            ::   |.|:::        |..::.||:.||..|||:..:|    ||.....:.||:...::..|
  Rat    88 WDGKSLKPDSV--------RSQLETSLKRLQCPRVDLFYLH----APDHGTPIVETLQACQQLHQ 140

  Fly   170 AGKARFIGVTAYD----VDVLKECAERGKGRIQVVLNYARYTL----LDNTLLRHMKAFQEMGVG 226
            .||...:|::.|.    .::...|  :..|.|...:....|..    ::..||..::.|     |
  Rat   141 EGKFVELGLSNYASWEVAEIYTLC--KSNGWILPTVYQGMYNATTRQVETELLPCLRYF-----G 198

  Fly   227 VVCAAAHSL--GLLSNA-------GPQSWHPGSPELLAVGKRGAEICQKR--------------- 267
            :...|.:.|  |||:..       |.|      ||....|...:|..:.|               
  Rat   199 LRFYAYNPLAGGLLTGKYRYEDKDGKQ------PEGRFFGNSWSETYRNRFWKEHHFEAIALVEK 257

  Fly   268 --NVELGKLA----------MYYTMQLDGAA--TFLIGIPNRKLLRINLDAIFDG 308
              ....|..|          ||:..||.|..  ..::|:.:.:.|..||.|..:|
  Rat   258 ALKTTYGTSAPSMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 70/309 (23%)
Aldo_ket_red 24..322 CDD:294321 72/315 (23%)
Akr7a2NP_599234.1 Tas 21..334 CDD:223739 72/315 (23%)
Aldo_ket_red 21..325 CDD:119408 72/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396894at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.