DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Kcnab2

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_011248499.1 Gene:Kcnab2 / 16498 MGIID:109239 Length:414 Species:Mus musculus


Alignment Length:372 Identity:87/372 - (23%)
Similarity:148/372 - (39%) Gaps:94/372 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLRVSKIALG-GATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEE 85
            |:||.||.:|||||.:.|| ..|.....:|:.  .|.::|:  |..:|||..|||..|..||:|.
Mouse    68 MKYRNLGKSGLRVSCLGLGTWVTFGGQITDEM--AEHLMTL--AYDNGINLFDTAEVYAAGKAEV 128

  Fly    86 LLGQALKDV--PREAYYIATKVARYELDPNNMFDYTAAKAR-----------ESVKRSLELLQLD 137
            :||..:|..  .|.:..|.||:            :...||.           |.:|.|||.|||:
Mouse   129 VLGNIIKKKGWRRSSLVITTKI------------FWGGKAETERGLSRKHIIEGLKASLERLQLE 181

  Fly   138 RVDVLQVHDVDAAPSLDM--------------VLNETIPVLEEYVQAGKARFIGVTAYDVDVLKE 188
            .|||:..:..|  |:..|              ::.||:..:...:..|.|.:.|.:.:....:.|
Mouse   182 YVDVVFANRPD--PNTPMEAGDPFSSFKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIME 244

  Fly   189 C--AERGKGRIQVVLNYARYTLL--DNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSWHPG 249
            .  ..|....|..:...|.|.:.  :...::..:.|.::|||.:..:..:.|::|.    .:..|
Mouse   245 AYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSG----KYDSG 305

  Fly   250 SPELLAVGKRGAE-----------------------ICQKRNVELGKLAMYYTMQLDGAATFLIG 291
            .|.......:|.:                       |.::....|.:||:.:.::.:|.::.|:|
Mouse   306 IPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLG 370

  Fly   292 IPNRKLLRINLDAIFDGLTSHEQEVLQYLRENVF--------TKSYS 330
            ..|.:.|..|:.||         :||..|..::.        .|.||
Mouse   371 ASNAEQLMENIGAI---------QVLPKLSSSIVHEIDSILGNKPYS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 79/336 (24%)
Aldo_ket_red 24..322 CDD:294321 83/352 (24%)
Kcnab2XP_011248499.1 Aldo_ket_red_shaker 69..394 CDD:381367 83/355 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.