DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AKR1C1

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001344.2 Gene:AKR1C1 / 1645 HGNCID:384 Length:323 Species:Homo sapiens


Alignment Length:301 Identity:76/301 - (25%)
Similarity:126/301 - (41%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AIRSGINYIDTAPFYGQGKSEELLGQALK------DVPREAYYIATKV----ARYELDPNNMFDY 118
            ||.:|..:||:|..|   .:||.:|.|::      .|.||..:..:|:    .|.||        
Human    41 AIEAGFRHIDSAHLY---NNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPEL-------- 94

  Fly   119 TAAKARESVKRSLELLQLDRVDVLQVH-DVDAAPSLDM--------VLNETIPV------LEEYV 168
                .|.:::|||:.||||.||:..:| .|...|..::        :|.:|:.:      :|:..
Human    95 ----VRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCK 155

  Fly   169 QAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTLLRHMKAFQE------MGV 225
            .||.|:.|||:.::           :.:::::||.  .:|..:.|.:..|....|.      ...
Human   156 DAGLAKSIGVSNFN-----------RRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSK 209

  Fly   226 GVVCAAAHSLGLLSNAGPQSW-HPGSPELL------AVGKRGAEICQKRNVELGKLAMYYTMQLD 283
            .:|..|..:||   :...:.| .|.||.||      |:.|:     .||...|  :|:.|  ||.
Human   210 DIVLVAYSALG---SHREEPWVDPNSPVLLEDPVLCALAKK-----HKRTPAL--IALRY--QLQ 262

  Fly   284 GAATFLIGIPNRKLLRINLDAIFDGLTSHEQEVLQYLRENV 324
            .....|....|.:.:|.|:......|||.|.:.:..|..||
Human   263 RGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 69/279 (25%)
Aldo_ket_red 24..322 CDD:294321 74/297 (25%)
AKR1C1NP_001344.2 AKR_AKR1C1-35 6..308 CDD:381334 76/301 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.