DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1b8

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_032038.1 Gene:Akr1b8 / 14187 MGIID:107673 Length:316 Species:Mus musculus


Alignment Length:314 Identity:74/314 - (23%)
Similarity:126/314 - (40%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGINYIDTAPFYGQGKSEELLGQAL------KDVPREAYYIATKVARYELDPNNMFDYT 119
            |:.||.:|..:||.|..|   .:|..:|:|:      |.|.||..:|.:|     |.| ..|:..
Mouse    32 VKAAIDAGYRHIDCAYAY---CNENEVGEAIQEKIKEKAVQREDLFIVSK-----LWP-TCFEKK 87

  Fly   120 AAKARESVKRSLELLQLDRVDVLQVH-------DVDAAPSLDM--VLN------ETIPVLEEYVQ 169
            ..|  |:.:::|..|:||.:|:..:|       ..:..|..|.  :|.      |....:||.|.
Mouse    88 LLK--EAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDDQGRILTSKTTFLEAWEGMEELVD 150

  Fly   170 AGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTLLRHMKAFQEMGVGVVCAAA 232
            .|..:.:||:.::           ..:|:.:||.  .::..:.|.:..|....||.    :....
Mouse   151 QGLVKALGVSNFN-----------HFQIERLLNKPGLKHKPVTNQVECHPYLTQEK----LIQYC 200

  Fly   233 HSLGL-------LSNAGPQSWHPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAATFLI 290
            ||.|:       |.:....|..|..|.||...|. .||..|......::.:.:.:|.:.......
Mouse   201 HSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKI-KEIAAKHEKTSAQVLIRFHIQRNVVVIPKS 264

  Fly   291 GIPNRKLLRINLDAIFDGLTSHEQ--EVLQYLRENVFTKSYSWGSTL--STVNM 340
            ..|:|  ::.|:. :||...|.|:  .:|.:.|        :|.:.|  .||||
Mouse   265 VTPSR--IQENIQ-VFDFQLSDEEMATILSFNR--------NWRACLLPETVNM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 62/272 (23%)
Aldo_ket_red 24..322 CDD:294321 67/292 (23%)
Akr1b8NP_032038.1 ARA1 1..297 CDD:223729 68/302 (23%)
Tas 16..289 CDD:223739 66/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.