DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1b7

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_033861.2 Gene:Akr1b7 / 11997 MGIID:101918 Length:316 Species:Mus musculus


Alignment Length:297 Identity:62/297 - (20%)
Similarity:118/297 - (39%) Gaps:70/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGINYIDTAPFYGQGKSEELLGQALKD------VPREAYYIATKV-ARYELDPNNMFDY 118
            |:.||.:|..:||.|..|   .:|..:|:|:::      |.||..:|.:|: |.:         :
Mouse    32 VKAAIDAGYRHIDCAYVY---HNENEVGEAIQEKIKENAVKREDLFIVSKLWATF---------F 84

  Fly   119 TAAKARESVKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIP-------------------VL 164
            ..:..:::.:.:|..|:||.:|:..||    .|......|..:|                   .:
Mouse    85 EKSLVKKAFQNTLSDLKLDYLDLYLVH----WPQGFQAGNALLPKDNKGKVLLSKSTFLDAWEAM 145

  Fly   165 EEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTLLRHMKAFQE----- 222
            ||.|..|..:.:|::.::           ..:|:.:||.  .::..:.|.:..|....||     
Mouse   146 EELVDQGLVKALGISNFN-----------HFQIERLLNKPGLKHKPVTNQIESHPYLTQEKLIQY 199

  Fly   223 -MGVGVVCAAAHSLGLLSNAGPQSWHPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAA 286
             ...|:...|...||  |...|.: .|..|.::.:.|. .||..|....:.::.:.:.:|.:...
Mouse   200 CQSKGIAVTAYSPLG--SPDRPYA-KPEDPVVMEIPKI-KEIAAKHKKTVAQVLIRFHVQRNVVV 260

  Fly   287 TFLIGIPNRKLLRINLDAIFDGLTSHEQ--EVLQYLR 321
            ......|:|  ::.||. :||...|.|.  .:|.:.|
Mouse   261 IPKSVTPSR--IQENLQ-VFDFQLSEEDMAAILSFNR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 56/276 (20%)
Aldo_ket_red 24..322 CDD:294321 62/297 (21%)
Akr1b7NP_033861.2 AKR_AKR1B1-19 10..316 CDD:381333 62/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.