DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and Akr1b7

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:293 Identity:62/293 - (21%)
Similarity:117/293 - (39%) Gaps:79/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGINYIDTAPFYGQGKSEELLGQAL------KDVPREAYYIATKVARYELDPNNMFDYT 119
            |:.||.:|..:.|.|..| |.:||  :|:|:      |.|.||..:|.:|:.      :..|:.:
  Rat    45 VKAAIDAGYRHFDCAYVY-QNESE--VGEAIQEKIKEKAVRREDLFIVSKLW------STFFEKS 100

  Fly   120 AAKARESVKRSLELLQLDRVDVLQVH------------DVDAAPSLDMVLNETIPV---LEEYVQ 169
            ..|  |:.:::|..|:||.:|:..:|            ..|:...:.|..:..:..   :||.|.
  Rat   101 LMK--EAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVD 163

  Fly   170 AGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTLLRHMKAFQEMGV------G 226
            .|..:.:||:.::           ..:|:.:||.  .::..:.|.:..|....||..:      |
  Rat   164 QGLVKALGVSNFN-----------HFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKG 217

  Fly   227 VVCAAAHSLGLLSNAGPQSWHPGSPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAATFLIG 291
            :...|...||  |...|.: .|..|.:|.:.|. .||..|....:.::.:.:.:|.:.|.     
  Rat   218 IAVIAYSPLG--SPDRPYA-KPEDPVVLEIPKI-KEIAAKHKKTIAQVLIRFHVQRNVAV----- 273

  Fly   292 IPNRKLLRINLDAIFDGLTSHEQEVLQYLRENV 324
            ||                   :...|.:::||:
  Rat   274 IP-------------------KSVTLSHIKENI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 59/271 (22%)
Aldo_ket_red 24..322 CDD:294321 60/289 (21%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 62/293 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.