DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AKR1C4

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001809.4 Gene:AKR1C4 / 1109 HGNCID:387 Length:323 Species:Homo sapiens


Alignment Length:305 Identity:75/305 - (24%)
Similarity:122/305 - (40%) Gaps:68/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 REEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQALK------DVPREAYYIATKVARYELDP 112
            |...:...:.||.:|..:||:|..|   .:||.:|.|::      .|.||..:..:|:......|
Human    31 RNRAVEVTKLAIEAGFRHIDSAYLY---NNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQP 92

  Fly   113 NNMFDYTAAKARESVKRSLELLQLDRVDVLQVH--------------DVDAAPSLDMV-LNETIP 162
            .        ..:.:::.||:.||||.||:..:|              |.:.....|.| |:.|..
Human    93 Q--------MVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWE 149

  Fly   163 VLEEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTL-----LRHMKAF 220
            |:|:...||.|:.|||:.::      |.:     ::::||.  .:|..:.|.:     |...|..
Human   150 VMEKCKDAGLAKSIGVSNFN------CRQ-----LEMILNKPGLKYKPVCNQVECHPYLNQSKLL 203

  Fly   221 QEMGVGVVCAAAHSLGLLSNAGPQSW-HPGSPELL------AVGKRGAEICQKRNVELGKLAMYY 278
            .......:...|||  .|.....:.| .|.||.||      |:.|:     .|:...|  :|:.|
Human   204 DFCKSKDIVLVAHS--ALGTQRHKLWVDPNSPVLLEDPVLCALAKK-----HKQTPAL--IALRY 259

  Fly   279 TMQLDGAATFLIGIPNRKLLRINLDAIFDGLTSHEQEVLQYLREN 323
              ||......|....|.:.:|.|:......|||.:.:||..|..|
Human   260 --QLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 68/284 (24%)
Aldo_ket_red 24..322 CDD:294321 74/302 (25%)
AKR1C4NP_001809.4 AKR_AKR1C1-35 6..306 CDD:381334 75/305 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.