DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and YPR127W

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_015452.1 Gene:YPR127W / 856245 SGDID:S000006331 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:40/224 - (17%)
Similarity:82/224 - (36%) Gaps:60/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LDPKNMFDYSADKARESVKRSLERLQLDRVDILQVHDVDAA--PNLDIVLNETIPVLEEYVQAGK 168
            |.|:.    |.|...:|||.|:..:. ..:||.:|..:|.:  ...::...|:...|.|.:..|.
Yeast    97 LTPRG----SHDDVVQSVKNSVSAIG-GYIDIFEVARIDTSLCTKGEVYPYESFEALAEMISEGV 156

  Fly   169 ARFIGVTAYDVDVLKECAERGKGR----IQVVLNYARYTLLDNTLLRYMKDFQKMGVGVVCAAAH 229
            ...|.::..:.:.:: ...:..|:    ::|.|:.....:|.|.:   .|...::|:.::|.:..
Yeast   157 IGGISLSEVNEEQIR-AIHKDWGKFLTCVEVELSLFSNDILHNGI---AKTCAELGLSIICYSPL 217

  Fly   230 SLGLLRNAGPHASHPGSQEILAVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIGIPNRKLL 294
            ..|||                                        |.||...|....|...:.|.
Yeast   218 GRGLL----------------------------------------TGQLKSNADIPEGDFRKSLK 242

  Fly   295 RINLDAIFDGLTSHEQEVLQYLRENVFTK 323
            |.:.:::...||     ::::|:|.:..|
Yeast   243 RFSDESLKKNLT-----LVRFLQEEIVDK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 37/210 (18%)
YPR127WNP_015452.1 AKR_AKR8A1-2 8..329 CDD:381303 40/224 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.