DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and AAD10

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_012689.1 Gene:AAD10 / 853620 SGDID:S000003916 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:39/152 - (25%)
Similarity:66/152 - (43%) Gaps:33/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 REAYYIATKVARYGLDPKNMFDYSADKARE-----------SVKRSLERLQLDRVDILQVHDVDA 145
            |:...||||   :..|.|. :|....|:..           ||:.||.:||.|.:|||.||..|.
Yeast     7 RDQIVIATK---FTTDYKG-YDVGKGKSANFCGNHKRSLHVSVRDSLRKLQTDWIDILYVHWWDY 67

  Fly   146 APNLDIVLNETIPVLEEYVQAGKARFIGVT---AYDVDVLKECAERGKGRIQVVLNYARYTLLDN 207
            ..:::.|::.    |...||.||..::||:   |:.|......| ...|:....:...::.:|: 
Yeast    68 MSSIEEVMDS----LHILVQQGKVLYLGVSDTPAWVVSAANYYA-TSHGKTPFSIYQGKWNVLN- 126

  Fly   208 TLLRYMKDFQKMGVGVVCAAAH 229
                  :||::   .::..|.|
Yeast   127 ------RDFER---DIIPMARH 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 39/152 (26%)
AAD10NP_012689.1 AKR_SF <1..250 CDD:412396 39/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.