DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and KCNAB2

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_016858110.1 Gene:KCNAB2 / 8514 HGNCID:6229 Length:435 Species:Homo sapiens


Alignment Length:367 Identity:89/367 - (24%)
Similarity:152/367 - (41%) Gaps:89/367 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLHVSKLAIG-----GSPLCNLFFDDYDREEGILMVQEAIRSGINYIDTAPFL--- 78
            |:||.||.:||.||.|.:|     |..:.:      :..|.::.:  |..:|||..|||...   
Human    90 MKYRNLGKSGLRVSCLGLGTWVTFGGQITD------EMAEQLMTL--AYDNGINLFDTAEVYAAG 146

  Fly    79 -SEVLLGQALKDV--PREAYYIATKV-------ARYGLDPKNMFDYSADKARESVKRSLERLQLD 133
             :||:||..:|..  .|.:..|.||:       ...||..|::.        |.:|.|||||||:
Human   147 KAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHII--------EGLKASLERLQLE 203

  Fly   134 RVDILQVHDVDAAPNLDI-------------VLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC 185
            .||::..:..|  ||..:             ::.||:..:...:..|.|.:.|.:.:....:.|.
Human   204 YVDVVFANRPD--PNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEA 266

  Fly   186 --AERGKGRIQVVLNYARYTLL--DNTLLRYMKDFQKMGVGVVCAAAHSLGLLR---NAG--PH- 240
              ..|.......:...|.|.:.  :...::..:.|.|:|||.:..:..:.|::.   ::|  |: 
Human   267 YSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYS 331

  Fly   241 -ASHPGSQ----EIL--------AVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIGIPNRK 292
             ||..|.|    :||        |..|....|.::....|.:||:.:.::.:|.::.|:|..|..
Human   332 RASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAD 396

  Fly   293 LLRINLDAIFDGLTSHEQEVLQYLRENVF--------TKSYS 326
            .|..|:.||         :||..|..::.        .|.||
Human   397 QLMENIGAI---------QVLPKLSSSIIHEIDSILGNKPYS 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 83/342 (24%)
KCNAB2XP_016858110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.