DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and kcnab2a

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_021335580.1 Gene:kcnab2a / 797337 ZFINID:ZDB-GENE-140515-2 Length:430 Species:Danio rerio


Alignment Length:354 Identity:89/354 - (25%)
Similarity:152/354 - (42%) Gaps:78/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLHVSKLAIG-----GSPLCNLFFDDYDREEGILMVQEAIRSGINYIDTAPFL--- 78
            |:||.||.:||.||.|.:|     |..:.:      :..|.::.:  |..:|||..|||...   
Zfish   100 MKYRNLGKSGLRVSCLGLGTWVTFGGQITD------EMAEQLMTL--AYENGINLFDTAEVYAAG 156

  Fly    79 -SEVLLGQALKDV--PREAYYIATKV-------ARYGLDPKNMFDYSADKARESVKRSLERLQLD 133
             :||:||..:|..  .|.:..|.||:       ...||..|::.        |.:|.|||||||:
Zfish   157 KAEVVLGNVIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHII--------EGLKASLERLQLE 213

  Fly   134 RVDILQVHDVDAAPNLDIVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC--AERGKGRIQVV 196
            .||::..:..|  ||..  :.||:..:...:..|.|.:.|.:.:....:.|.  ..|...:|..:
Zfish   214 YVDVVFANRPD--PNTP--MEETVRAMTHVINQGMAMYWGTSRWSPMEIMEAYSVARQFNQIPPI 274

  Fly   197 LNYARYTLL--DNTLLRYMKDFQKMGVGVVCAAAHSLGLLR---NAG--PH--ASHPGSQ----E 248
            ...:.|.:.  :...::..:.|.|:|||.:..:..:.|::.   ::|  |:  ||..|.|    :
Zfish   275 CEQSEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIISGKYDSGVPPYSRASLKGYQWLKDK 339

  Fly   249 IL--------AVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINLDAIFDGL 305
            ||        |..|....|.::....|.:||:.:.::.:|.::.|:|..|...|..|:.||    
Zfish   340 ILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNTDQLMENIGAI---- 400

  Fly   306 TSHEQEVLQYLRENVF--------TKSYS 326
                 :||..|..::.        .|.||
Zfish   401 -----QVLPKLSSSIVHEVDSILGNKPYS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 83/329 (25%)
kcnab2aXP_021335580.1 Kv_beta 102..418 CDD:213602 85/344 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.