DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and KCNAB1

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_751892.1 Gene:KCNAB1 / 7881 HGNCID:6228 Length:419 Species:Homo sapiens


Alignment Length:346 Identity:82/346 - (23%)
Similarity:147/346 - (42%) Gaps:64/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLHVSKLAIG-----GSPLCNLFFDDYDREEGILMVQEAIRSGINYIDTAPFL--- 78
            |.:|.||.:||.||.|.:|     |..:.:      :..|.::.:  |..||:|..|||...   
Human    89 MPHRNLGKSGLRVSCLGLGTWVTFGGQISD------EVAERLMTI--AYESGVNLFDTAEVYAAG 145

  Fly    79 -SEVLLGQALKDV--PREAYYIATKV-------ARYGLDPKNMFDYSADKARESVKRSLERLQLD 133
             :||:||..:|..  .|.:..|.||:       ...||..|::.        |.:|.||:||||:
Human   146 KAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHII--------EGLKGSLQRLQLE 202

  Fly   134 RVDILQVHDVDAAPNLDIVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC--AERGKGRIQVV 196
            .||::..:    .|:.:..:.|.:..:...:..|.|.:.|.:.:....:.|.  ..|....|..|
Human   203 YVDVVFAN----RPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPV 263

  Fly   197 LNYARYTLL--DNTLLRYMKDFQKMGVGVVCAAAHSLGLLR----NAGPHASHPG-------SQE 248
            ...|.|.|.  :...::..:.:.|:|||.:..:..:.|::.    |..|.:|...       .:.
Human   264 CEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKER 328

  Fly   249 ILAVAKRGAE--------ICQQRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINLDAI--FD 303
            |::...|..:        |.::....|.:||:.:.::.:|.::.|:|....:.|..||.||  ..
Human   329 IVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLP 393

  Fly   304 GLTSH-EQEVLQYLRENVFTK 323
            .:||| ..|:...||...::|
Human   394 KMTSHVVNEIDNILRNKPYSK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 78/332 (23%)
KCNAB1NP_751892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
Kv_beta 91..407 CDD:213602 78/335 (23%)
Aldo_ket_red 91..406 CDD:119408 78/334 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.