DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and AKR1B10

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_064695.3 Gene:AKR1B10 / 57016 HGNCID:382 Length:316 Species:Homo sapiens


Alignment Length:248 Identity:55/248 - (22%)
Similarity:94/248 - (37%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGINYIDTA-PFLSEVLLGQAL------KDVPREAYYIATKVARYGLDPKNMFDYSADK 118
            |:.||.:|..:||.| .:.:|..:|:|:      |.|.||..:|.:|     |.|.   .:....
Human    32 VKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSK-----LWPT---FFERPL 88

  Fly   119 ARESVKRSLERLQLDRVDILQVH-------DVDAAPNLD--------IVLNETIPVLEEYVQAGK 168
            .|::.:::|:.|:|..:|:..:|       ..|..|..|        ....:....:||.|..|.
Human    89 VRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELVDEGL 153

  Fly   169 ARFIGVTAYDVDVLKECAERGKGRIQVVLNYAR---YTLLDNTLLRYMKDFQKMGVGVVCAAAHS 230
            .:.:||:.:....:::...:...:.:.|.|...   | |....|::|..     ..|:...|...
Human   154 VKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPY-LTQEKLIQYCH-----SKGITVTAYSP 212

  Fly   231 LG-------------LLRNAGPHASHPGSQEILAVAKRGA-----EICQQRNV 265
            ||             ||.:       |..:||.|..|:.|     ....||||
Human   213 LGSPDRPWAKPEDPSLLED-------PKIKEIAAKHKKTAAQVLIRFHIQRNV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 55/248 (22%)
AKR1B10NP_064695.3 AKR_AKR1B1-19 10..316 CDD:381333 55/248 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.