DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and Kcnab2

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_017448703.1 Gene:Kcnab2 / 29738 RGDID:61828 Length:383 Species:Rattus norvegicus


Alignment Length:366 Identity:89/366 - (24%)
Similarity:152/366 - (41%) Gaps:90/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YRQLGSTGLHVSKLAIG-----GSPLCNLFFDDYDREEGILMVQEAIRSGINYIDTAPFL----S 79
            ||.||.:||.||.|.:|     |..:.:      :..|.::.:  |..:|||..|||...    :
  Rat    39 YRNLGKSGLRVSCLGLGTWVTFGGQITD------EMAEHLMTL--AYDNGINLFDTAEVYAAGKA 95

  Fly    80 EVLLGQALKDV--PREAYYIATKV-------ARYGLDPKNMFDYSADKARESVKRSLERLQLDRV 135
            ||:||..:|..  .|.:..|.||:       ...||..|::.        |.:|.|||||||:.|
  Rat    96 EVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHII--------EGLKASLERLQLEYV 152

  Fly   136 DILQVHDVDAAPNLDI--------------VLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC- 185
            |::..:..|  ||..:              ::.||:..:...:..|.|.:.|.:.:....:.|. 
  Rat   153 DVVFANRPD--PNTPMEAGDPFSSFKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAY 215

  Fly   186 -AERGKGRIQVVLNYARYTLL--DNTLLRYMKDFQKMGVGVVCAAAHSLGLLR---NAG--PH-- 240
             ..|....|..:...|.|.:.  :...::..:.|.|:|||.:..:..:.|::.   ::|  |:  
  Rat   216 SVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSR 280

  Fly   241 ASHPGSQ----EIL--------AVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIGIPNRKL 293
            ||..|.|    :||        |..|....|.::....|.:||:.:.::.:|.::.|:|..|.:.
  Rat   281 ASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQ 345

  Fly   294 LRINLDAIFDGLTSHEQEVLQYLRENVF--------TKSYS 326
            |..|:.||         :||..|..::.        .|.||
  Rat   346 LMENIGAI---------QVLPKLSSSIVHEIDSILGNKPYS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 83/341 (24%)
Kcnab2XP_017448703.1 Aldo_ket_red_shaker 38..363 CDD:381367 86/350 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5200
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.