DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and AKR7L

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001335350.1 Gene:AKR7L / 246181 HGNCID:24056 Length:331 Species:Homo sapiens


Alignment Length:293 Identity:69/293 - (23%)
Similarity:109/293 - (37%) Gaps:76/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IRSGINYIDTAPFL-----SEVLLG-----QALKDVPREAYYIATKVARY---GLDPKNMFDYSA 116
            :..|...|||| ||     ||.:||     ....|.   ...||||...:   .|.|        
Human    36 LERGHTEIDTA-FLYSDGQSETILGGLGLRMGSSDC---RVKIATKANPWIGNSLKP-------- 88

  Fly   117 DKARESVKRSLERLQLDRVDILQVHDVDAAPNLDIVLNETIPVLEEYVQAGKARFIGVTAYDV-D 180
            |..|..::.||:|||..|||:..:|    ||:....:.||:....:..|.||...:|::.|.. :
Human    89 DSVRSQLETSLKRLQCPRVDLFYLH----APDHSAPVEETLRACHQLHQEGKFVELGLSNYAAWE 149

  Fly   181 VLKECAE-RGKGRIQVVLNYARYTL----LDNTLLRYMKDFQKMGVGVVCAAAHSL--GLLRNAG 238
            |.:.|.. :..|.|...:....|:.    ::..|...::.|     |:...|.:.|  |||....
Human   150 VAEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHF-----GLRFYAYNPLAGGLLTGKY 209

  Fly   239 PHASHPGSQEI------------------------LAVAKR------GAEICQQRNVELGKLAMY 273
            .:....|.|.:                        :|:.::      ||......:..|  ..||
Human   210 KYEDKDGKQPVGRFFGTQWAEIYRNHFWKEHHFEGIALVEKALQAAYGASAPSMTSAAL--RWMY 272

  Fly   274 YTMQLDGA--ATFLIGIPNRKLLRINLDAIFDG 304
            :..||.||  ...::|:.:.:.|..||.|..:|
Human   273 HHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 69/293 (24%)
AKR7LNP_001335350.1 Aldo_ket_red 10..318 CDD:119408 69/293 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396894at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.