DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and C07D8.6

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_509242.1 Gene:C07D8.6 / 180997 WormBaseID:WBGene00015565 Length:317 Species:Caenorhabditis elegans


Alignment Length:263 Identity:63/263 - (23%)
Similarity:110/263 - (41%) Gaps:69/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 STGLHVSKLAIG---GSPLCNLFFDDYDREEGILMVQEAIRSGINYIDTAP-FLSEVLLGQALKD 89
            |.|:.:..:.:|   .||           .|.|..|:.|:::|...||||. :.:|..:|.|:|:
 Worm    11 SNGVEMPVIGLGTWQSSP-----------AEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKE 64

  Fly    90 ------VPREAYYIATKVARYGLDPKNMFDYSADKARESVKRSLERLQLDRVDILQVHDVDAAPN 148
                  |.||..:|.||...:.|.|        .|....::.||::|||:.||:...| :.||.|
 Worm    65 LLEEGVVKREELFITTKAWTHELAP--------GKLEGGLRESLKKLQLEYVDLYLAH-MPAAFN 120

  Fly   149 LDIVLNETIPVLEEYVQ------AGKARFIGVTAYDVDVLKECAERG-----KGRIQVVLNYARY 202
            .|:..:...||.:.:.|      ||.|:.:||:.::.|.:......|     ..::::.|.:.::
 Worm   121 DDMSEHIASPVEDVWRQFDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQH 185

  Fly   203 TLLDNTLLRYMKDFQKMGVGVVCAAAHSLGLLRNAG---------------PHASHPGSQEILAV 252
            ..:|     :.|   |..:.|.     |...|.:.|               |..|....|.:||:
 Worm   186 DHVD-----FCK---KHNISVT-----SYATLGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLAL 237

  Fly   253 AKR 255
            |::
 Worm   238 AEK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 63/263 (24%)
C07D8.6NP_509242.1 AKR_AKR1G1_CeAKR 5..301 CDD:381380 63/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.