DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and F53F1.2

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001379192.1 Gene:F53F1.2 / 179821 WormBaseID:WBGene00009980 Length:297 Species:Caenorhabditis elegans


Alignment Length:185 Identity:52/185 - (28%)
Similarity:80/185 - (43%) Gaps:46/185 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQEAIRSGINYIDTAP-FLSEVLLGQALKDVPREAYYIATKVARYGLDPKNMFDYS-----ADKA 119
            :..|:.:|....|||. :|:|..||:|||.:          :.::||...::|..|     :...
 Worm    40 IDAALTAGYRMFDTAKYYLNEKELGEALKIL----------LPKHGLSRSDVFLTSKFFPESKNC 94

  Fly   120 RES----VKRSLERLQLDRVDILQVH----------DVDAAPNLDIVLNETIPVLEEYVQAGKAR 170
            ||:    |:.||:.||.|.:|:..||          ||:.|....|...    ||||...|||.|
 Worm    95 REACRGFVEESLQSLQTDYIDMYLVHYPKPNDSDNDDVNNAEYRKIAYE----VLEEAKAAGKVR 155

  Fly   171 FIGVTAYDVDVLKECAERGKGRIQVVLNYARYTLLDNTLLRYMKDFQKMGVGVVC 225
            .|||:.|::..|:|           :..||:.....|. |.|...|.::.:...|
 Worm   156 SIGVSNYEIVHLEE-----------LKTYAKVPPCANQ-LEYHPHFARIPLQKYC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 52/185 (28%)
F53F1.2NP_001379192.1 AKR_AKR1-5-like 21..279 CDD:381297 52/185 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.