DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and Akr7a2

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_599234.1 Gene:Akr7a2 / 171445 RGDID:620311 Length:338 Species:Rattus norvegicus


Alignment Length:310 Identity:69/310 - (22%)
Similarity:111/310 - (35%) Gaps:86/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DREEGILMVQEAIRSGINYIDTAPFL-----SEVLLGQ----------ALKDVPREAYYIATKVA 102
            |.......|:..:..|:|.:||| |:     ||.:||.          .:|        ||||..
  Rat    31 DASASAATVRAFLERGLNELDTA-FMYCDGQSESILGSLGLGLGSGDCTVK--------IATKAN 86

  Fly   103 RYGLDPKNMFDYSADKARESVKRSLERLQLDRVDILQVHDVDAAPNLDIVLNETIPVLEEYVQAG 167
            .:  |.|::   ..|..|..::.||:|||..|||:..:|    ||:....:.||:...::..|.|
  Rat    87 PW--DGKSL---KPDSVRSQLETSLKRLQCPRVDLFYLH----APDHGTPIVETLQACQQLHQEG 142

  Fly   168 KARFIGVTAYD----VDVLKECAERG-------KGRIQVVLNYARYTLLDNTLLRYMKDFQKMGV 221
            |...:|::.|.    .::...|...|       :|............||  ..|||.        
  Rat   143 KFVELGLSNYASWEVAEIYTLCKSNGWILPTVYQGMYNATTRQVETELL--PCLRYF-------- 197

  Fly   222 GVVCAAAHSL--GLLRNAGPHASHPGSQ------------------------EILAVAKRGAEIC 260
            |:...|.:.|  |||.....:....|.|                        |.:|:.::..:..
  Rat   198 GLRFYAYNPLAGGLLTGKYRYEDKDGKQPEGRFFGNSWSETYRNRFWKEHHFEAIALVEKALKTT 262

  Fly   261 QQRNVELGKLA----MYYTMQLDGAA--TFLIGIPNRKLLRINLDAIFDG 304
            ...:......|    ||:..||.|..  ..::|:.:.:.|..||.|..:|
  Rat   263 YGTSAPSMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 69/310 (22%)
Akr7a2NP_599234.1 Tas 21..334 CDD:223739 69/310 (22%)
Aldo_ket_red 21..325 CDD:119408 69/310 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396894at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.