DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and AKR1C4

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001809.4 Gene:AKR1C4 / 1109 HGNCID:387 Length:323 Species:Homo sapiens


Alignment Length:308 Identity:75/308 - (24%)
Similarity:128/308 - (41%) Gaps:78/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 REEGILMVQEAIRSGINYIDTA-PFLSEVLLGQALK------DVPREAYYIATKVARYGLDPKNM 111
            |...:.:.:.||.:|..:||:| .:.:|..:|.|::      .|.||..:..:|:......|:  
Human    31 RNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQ-- 93

  Fly   112 FDYSADKARESVKRSLERLQLDRVDILQVH--------------DVDAAPNLDIV-LNETIPVLE 161
                  ..:.:::.||::||||.||:..:|              |.:.....|.| |:.|..|:|
Human    94 ------MVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVME 152

  Fly   162 EYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLNY--ARYTLLDNTL-----LRYMK--DFQ 217
            :...||.|:.|||:.::      |.:     ::::||.  .:|..:.|.:     |...|  ||.
Human   153 KCKDAGLAKSIGVSNFN------CRQ-----LEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFC 206

  Fly   218 KMGVGVVCAAAHSLGLLRNAGPHASH-----PGSQEIL------AVAKRGAEICQQRNVELGKLA 271
            | ...:|..|..:||..|       |     |.|..:|      |:||:     .::...|  :|
Human   207 K-SKDIVLVAHSALGTQR-------HKLWVDPNSPVLLEDPVLCALAKK-----HKQTPAL--IA 256

  Fly   272 MYYTMQLDGAATFLIGIPNRKLLRINLDAIFDGLTSHEQEVLQYLREN 319
            :.|  ||......|....|.:.:|.|:......|||.:.:||..|..|
Human   257 LRY--QLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 71/298 (24%)
AKR1C4NP_001809.4 AKR_AKR1C1-35 6..306 CDD:381334 75/308 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.