DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12224 and kcnab2

DIOPT Version :9

Sequence 1:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_017950940.2 Gene:kcnab2 / 100486636 XenbaseID:XB-GENE-990281 Length:455 Species:Xenopus tropicalis


Alignment Length:369 Identity:90/369 - (24%)
Similarity:151/369 - (40%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRQLGSTGLHVSKLAIG-----GSPLCNLFFDDYDREEGILMVQEAIRSGINYIDTAPFL--- 78
            |:||.||.:||.||.|.:|     |..:.:      :..|.::.:  |..:|||..|||...   
 Frog   110 MKYRNLGKSGLRVSCLGLGTWVTFGGQITD------EMAEQLMTL--AYDNGINLFDTAEVYAAG 166

  Fly    79 -SEVLLGQALKDV--PREAYYIATKV-------ARYGLDPKNMFDYSADKARESVKRSLERLQLD 133
             :||:||..:|..  .|.:..|.||:       ...||..|::.        |.:|.||||||||
 Frog   167 KAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHII--------EGLKASLERLQLD 223

  Fly   134 RVDILQVHDVDAAPNLDI-------------VLNETIPVLEEYVQAGKARFIGVTAYDVDVLKEC 185
            .||::..:..|  ||..:             ::.||:..:...:..|.|.:.|.:.:....:.|.
 Frog   224 YVDVVFANRPD--PNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEA 286

  Fly   186 --AERGKGRIQVVLNYARYTLL--DNTLLRYMKDFQKMGVGVVCAAAHSLGLLRNAGPH------ 240
              ..|....|..:...|.|.:.  :...::..:.|.|:|||.:..:..:.|::  :|.:      
 Frog   287 YSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIV--SGKYDGGIPP 349

  Fly   241 ---ASHPGSQ----EIL--------AVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIGIPN 290
               ||..|.|    :||        |..|....|.::....|.:||:.:.::.:|.::.|:|..|
 Frog   350 YSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASN 414

  Fly   291 RKLLRINLDAIFDGLTSHEQEVLQYLRENVF--------TKSYS 326
            ...|..|:.||         :||..|..::.        .|.||
 Frog   415 ADQLLENIGAI---------QVLPKLSSSIIHEIDSILGNKPYS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 84/344 (24%)
kcnab2XP_017950940.2 Aldo_ket_red_shaker 111..435 CDD:381367 86/352 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.