DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and AKR1C3

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001240837.1 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens


Alignment Length:303 Identity:75/303 - (24%)
Similarity:123/303 - (40%) Gaps:81/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVKSGINYIDTAPWYGQGRSEEVLGLALK------DVPRESYYIATKV----ARYELDYDKMFDF 116
            |:::|..:||:|..|   .:||.:|||::      .|.||..:..:|:    .|.||        
Human    41 AIEAGFRHIDSAHLY---NNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPEL-------- 94

  Fly   117 SAKKTRESVEKSLKLLGLDYVDVIQIH---DIEFAKDL-----------DIV-INETLPTLEQLV 166
                .|.::|.|||...|||||:..||   .::..::|           ||| :..|...:|:..
Human    95 ----VRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCK 155

  Fly   167 KEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQNLGVICAAA 230
            ..|.|:.||||.:....|:..|.:...:...|..... :...:.:.|  |||.||::  ::..|.
Human   156 DAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKL--LDFCKSKD--IVLVAY 216

  Fly   231 HALGLLTNAGPQPW----HPASDEQK---AIARK--------ASEVCKERGVELGKLAMYYTMSG 280
            .|||   :...:.|    .|...|..   |:|:|        |.....:|||.:  ||..|    
Human   217 SALG---SQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVV--LAKSY---- 272

  Fly   281 LPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENV 323
                        ..|.:|.|:...|..|:.::.:.:..|..|:
Human   273 ------------NEQRIRQNVQVFEFQLTAEDMKAIDGLDRNL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 75/303 (25%)
Aldo_ket_red 24..321 CDD:294321 74/299 (25%)
AKR1C3NP_001240837.1 ARA1 9..305 CDD:223729 75/303 (25%)
Tas 17..297 CDD:223739 73/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.