DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and YPR127W

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_015452.1 Gene:YPR127W / 856245 SGDID:S000006331 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:48/237 - (20%)
Similarity:90/237 - (37%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ESVEKSLKLLGLDYVDVIQIH--DIEFAKDLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLK 185
            :||:.|:..:| .|:|:.::.  |.......::...|:...|.:::.||....|.:|......::
Yeast   108 QSVKNSVSAIG-GYIDIFEVARIDTSLCTKGEVYPYESFEALAEMISEGVIGGISLSEVNEEQIR 171

  Fly   186 -------EFLTRTAGRLDTVLTYARYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLT-----N 238
                   :|||.....|........:....:|..|.       .|.:||.:....||||     |
Yeast   172 AIHKDWGKFLTCVEVELSLFSNDILHNGIAKTCAEL-------GLSIICYSPLGRGLLTGQLKSN 229

  Fly   239 AGPQPWHPASDEQKAIARKASEVCKE-------------------RGVELGKLAMYYT--MSGLP 282
            |.    .|..|.:|::.|.:.|..|:                   ..:.|.:||:.:.  .:.:|
Yeast   230 AD----IPEGDFRKSLKRFSDESLKKNLTLVRFLQEEIVDKRPQNNSITLAQLALGWVKHWNKVP 290

  Fly   283 EVS--TFLTGMQTRQLLRI--NLDANEVGLSDKE-QEVLRYL 319
            |.|  .|:.......:.::  |.|..:..|:|:| ..:.:||
Yeast   291 EYSGAKFIPIPSGSSISKVNENFDEQKTKLTDQEFNAINKYL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 48/237 (20%)
Aldo_ket_red 24..321 CDD:294321 48/237 (20%)
YPR127WNP_015452.1 AKR_AKR8A1-2 8..329 CDD:381303 46/232 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.