DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and AAD14

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_014068.1 Gene:AAD14 / 855385 SGDID:S000005275 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:353 Identity:85/353 - (24%)
Similarity:152/353 - (43%) Gaps:75/353 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RNLGKT-GLQVSKVSFGGGAL-CANYGF----DLEEGIKTVHEAVKSGINYIDTAPWYGQGRSEE 83
            |.|.|| |::||.:..||.:: .|..||    :.|:..:.:....::|.|.||||..|....||.
Yeast    19 RVLSKTAGIRVSPLILGGASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEI 83

  Fly    84 VLG--LALKDVPRESYYIATKVA----RYELDYDKMFDFSAKKTRE---SVEKSLKLLGLDYVDV 139
            .:|  :|.:.: |:...||||..    :||:...|..::.....|.   ||..||:.|..|::|:
Yeast    84 WIGEWMASRKL-RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDI 147

  Fly   140 IQIHDIEFAKDLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLK--EFLTRTAGRLDTVLTYA 202
            :.||..::...    |.|.:.:|..||::||..::|||..|..|:.  .:...:.|:....:...
Yeast   148 LYIHWWDYMSS----IEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQG 208

  Fly   203 RYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQPW----------HPASDEQK----- 252
            ::.:.:.      ||.:.    :|..|.| .|:..    .||          ..|.:|:|     
Yeast   209 KWNVLNR------DFERD----IIPMARH-FGMAL----APWDVMGGGRFQSKKAMEERKKNGEG 258

  Fly   253 ---------------AIARKASEVCKERGVE-LGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINL 301
                           .|:...:::.:|.|.| :..:|:.|..|....|...:.|.:... |:.|:
Yeast   259 LRTFVGGPEQTELEVKISEALTKIAEEHGTESVTAIAIAYVRSKAKNVFPLIGGRKIEH-LKQNI 322

  Fly   302 DANEVGLSDKEQEVLRYLKENVLTKPFD 329
            :|..:.|:.::.|.|    |:::  |||
Yeast   323 EALSIKLTPEQIEYL----ESIV--PFD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 85/353 (24%)
Aldo_ket_red 24..321 CDD:294321 81/343 (24%)
AAD14NP_014068.1 AKR_AKR9A3_9B1-4 20..338 CDD:381373 80/342 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.