DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and AAD15

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_014477.1 Gene:AAD15 / 853999 SGDID:S000005525 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:23/83 - (27%)
Similarity:42/83 - (50%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 SDEQKAIARKASEVCKERGVE-LGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDK 311
            :|.:..|:...::|.:|.|.| :..:|:.|..|....|...:.|.:... |:.|:.|..:.|:  
Yeast    46 TDAEIKISEALAKVAEEHGTESVTAIAIAYVRSKAKNVFPSVEGGKIED-LKENIKALSIDLT-- 107

  Fly   312 EQEVLRYLKENVLTKPFD 329
             .:.::|| |||:  |||
Yeast   108 -PDNIKYL-ENVV--PFD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 23/83 (28%)
Aldo_ket_red 24..321 CDD:294321 17/73 (23%)
AAD15NP_014477.1 AKR_SF <1..115 CDD:412396 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.