DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and KCNAB2

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_016858110.1 Gene:KCNAB2 / 8514 HGNCID:6229 Length:435 Species:Homo sapiens


Alignment Length:359 Identity:89/359 - (24%)
Similarity:154/359 - (42%) Gaps:72/359 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRNLGKTGLQVSKVSFG-----GGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGRS 81
            |:||||||:||:||.:..|     ||.:..    ::.|.:.|:  |..:|||..|||..|..|::
Human    90 MKYRNLGKSGLRVSCLGLGTWVTFGGQITD----EMAEQLMTL--AYDNGINLFDTAEVYAAGKA 148

  Fly    82 EEVLG--LALKDVPRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVI- 140
            |.|||  :..|...|.|..|.||:   .:.|.:.    ..|.|...|.::.||:.|.|:||||: 
Human   149 EVVLGNIIKKKGWRRSSLVITTKIFWGGKAETER----GLSRKHIIEGLKASLERLQLEYVDVVF 209

  Fly   141 ----------QIHDIEFAKDLDIVINETLPTLEQLVKEGKARFIGVS---------AYPISVLKE 186
                      :......:|....:|.||:..:..::.:|.|.:.|.|         ||  ||.::
Human   210 ANRPDPNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAY--SVARQ 272

  Fly   187 F-LTRTAGRLDTVLTYARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLT---NAGPQPWH 245
            | ||      ..:...|.|.:  .::..::..:.|....:|.:..:..|.|:::   ::|..|:.
Human   273 FNLT------PPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYS 331

  Fly   246 PAS----------------DEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTR 294
            .||                ..|:|..::...:.:..|..|.:||:.:.:.. ..||:.|.|....
Human   332 RASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRN-EGVSSVLLGASNA 395

  Fly   295 QLLRINLDANEVGLSDKEQEVLRYLKENVLTKPF 328
            ..|..|:.|.:| |......::..:...:..||:
Human   396 DQLMENIGAIQV-LPKLSSSIIHEIDSILGNKPY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 89/359 (25%)
Aldo_ket_red 24..321 CDD:294321 86/348 (25%)
KCNAB2XP_016858110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 1 0.950 - 0.985475 Normalized mean entropy S2698
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.