DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and AAD4

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_010038.1 Gene:AAD4 / 851354 SGDID:S000002402 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:70/312 - (22%)
Similarity:134/312 - (42%) Gaps:55/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKDVP-RESYYIATKVA----RYELDYDK 112
            |:..:.:....::|.|.||||..|....||..:|..:|... |:...||||..    :||:...|
Yeast     7 EQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKLRDQIVIATKFTGDYKKYEVGGGK 71

  Fly   113 MFDFSAKKTRE---SVEKSLKLLGLDYVDVIQIHDIEFAKDLDIVINETLPTLEQLVKEGKARFI 174
            ..::.......   ||..||:.|..|::|::.:|..::...    |.|.:.:|..||::||..::
Yeast    72 SANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHWWDYMSS----IEEVMDSLHILVQQGKVLYL 132

  Fly   175 GVSAYPISVLK--EFLTRTAGRLDTVLTYARYTLTDETLLEYLDFFK-----SQNLGVICAAAHA 232
            |||..|..|:.  .:...:.|:....:...::.:.:.      ||.:     :::.|:..|....
Yeast   133 GVSDTPAWVVSAANYYATSHGKTPFSIYQGKWNVLNR------DFERDIIPMARHFGMALAPWDV 191

  Fly   233 L-------------------GLLTNAGPQPWHPASDEQKAIARKASEVCKERGVE-LGKLAMYYT 277
            :                   ||.|.:|..   ..:|::..|:...::|.:|.|.| :..:|:.|.
Yeast   192 MGGGRFQSKKAMEERKKNGEGLRTVSGTS---KQTDKEVKISEALAKVAEEHGTESVTAIAIAYV 253

  Fly   278 MSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFD 329
            .|....|...:.|.:... |:.|::|..:.|:.::.|.|    |:::  |||
Yeast   254 RSKAKNVFPLVGGRKIEH-LKQNIEALSIKLTPEQIEYL----ESII--PFD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 70/312 (22%)
Aldo_ket_red 24..321 CDD:294321 66/302 (22%)
AAD4NP_010038.1 AKR_AKR9A3_9B1-4 1..292 CDD:381373 66/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.