DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and KAB1

DIOPT Version :10

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_171963.1 Gene:KAB1 / 839450 AraportID:AT1G04690 Length:328 Species:Arabidopsis thaliana


Alignment Length:44 Identity:12/44 - (27%)
Similarity:17/44 - (38%) Gaps:15/44 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 WYQIAACSGVTPK--------------DPVKQLKKRVSSQKNTE 447
            |:.:.|.: :||:              ||....||.||..|..|
plant    78 WFDMPAPT-MTPELKRDLQLLKLRTVMDPAVHYKKSVSRSKLAE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 AKR_galDH 22..314 CDD:381389
KAB1NP_171963.1 AKR_AKR6C1_2 1..316 CDD:381369 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.