DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and KCNAB1

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_751892.1 Gene:KCNAB1 / 7881 HGNCID:6228 Length:419 Species:Homo sapiens


Alignment Length:343 Identity:88/343 - (25%)
Similarity:151/343 - (44%) Gaps:55/343 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRNLGKTGLQVS------KVSFGGGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGR 80
            |.:|||||:||:||      .|:|||     ....::.|.:.|:  |.:||:|..|||..|..|:
Human    89 MPHRNLGKSGLRVSCLGLGTWVTFGG-----QISDEVAERLMTI--AYESGVNLFDTAEVYAAGK 146

  Fly    81 SEEVLGLALKDV--PRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVI 140
            :|.:||..:|..  .|.|..|.||:   .:.|.:.    ..|.|...|.::.||:.|.|:||||:
Human   147 AEVILGSIIKKKGWRRSSLVITTKLYWGGKAETER----GLSRKHIIEGLKGSLQRLQLEYVDVV 207

  Fly   141 QIHDIEFAK--DLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKE--FLTRTAGRLDTVLTY 201
                  ||.  |.:..:.|.:..:..::.:|.|.:.|.|.:....:.|  .:.|....:..|...
Human   208 ------FANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQ 266

  Fly   202 ARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLT----NAGPQ---------PW---HPAS 248
            |.|.|  .::..::..:.:....:|.:..:..|.|:::    |..|:         .|   ...|
Human   267 AEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVS 331

  Fly   249 DE---QKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSD 310
            :|   |:...:..|.:.:..|..|.:||:.:.:.. ..||:.|.|..|.:.|..||.|.:| |..
Human   332 EEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRN-EGVSSVLLGSSTPEQLIENLGAIQV-LPK 394

  Fly   311 KEQEVLRYLKENVLTKPF 328
            ....|:..:...:..||:
Human   395 MTSHVVNEIDNILRNKPY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 88/343 (26%)
Aldo_ket_red 24..321 CDD:294321 85/332 (26%)
KCNAB1NP_751892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
Kv_beta 91..407 CDD:213602 85/334 (25%)
Aldo_ket_red 91..406 CDD:119408 85/333 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.