DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1cl

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_081858.2 Gene:Akr1cl / 70861 MGIID:1918111 Length:322 Species:Mus musculus


Alignment Length:309 Identity:70/309 - (22%)
Similarity:130/309 - (42%) Gaps:62/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKVA----RYELDYD 111
            |....|:.:|..:||:|.:|   ::||.:|||::.      |.||..:..:|:.    |.||   
Mouse    35 KATKIAIDAGFRHIDSAYFY---QNEEEVGLAIRSKVADGTVRREDIFYTSKLPCTCHRPEL--- 93

  Fly   112 KMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH---DIEFAKDL-----------DIV-INETLPT 161
                     .:..:|:||:.|.|||||:..||   .::...||           |.| :.:|...
Mouse    94 ---------VQPCLEQSLRKLQLDYVDLYLIHCPVSMKPGNDLIPTDENGKLLFDTVDLCDTWEA 149

  Fly   162 LEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQNLGV 225
            :|:....|.|:.||||.:....|:..|.:...|...|..... :...:::.|  ||:.||:::.:
Mouse   150 MEKCKDSGLAKSIGVSNFNRRQLEMILNKPGLRYKPVCNQVECHPYLNQSKL--LDYCKSKDIVL 212

  Fly   226 ICAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVC--KERGVELGKL--AMYYTMSGLPEVST 286
            :     |.|.|.:...:.|   .:|......:...:|  .|:..:...|  ..|....|:..|:.
Mouse   213 V-----AYGALGSQRCKNW---IEENAPYLLEDPTLCAMAEKHKQTPALISLRYLLQRGIVIVTK 269

  Fly   287 FLTGMQTRQLLRI---NLDANEVGLSDKEQEVLRYLKENVLTK----PF 328
            .....:.::.|::   :|.|.::.:.|:.....||....:::.    ||
Mouse   270 SFNEKRIKENLKVFEFHLPAEDMAVIDRLNRNYRYATARIISAHPNYPF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 70/309 (23%)
Aldo_ket_red 24..321 CDD:294321 68/296 (23%)
Akr1clNP_081858.2 ARA1 4..309 CDD:223729 68/298 (23%)
Tas 14..297 CDD:223739 65/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.