DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1b10

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_765986.3 Gene:Akr1b10 / 67861 MGIID:1915111 Length:316 Species:Mus musculus


Alignment Length:309 Identity:70/309 - (22%)
Similarity:124/309 - (40%) Gaps:86/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VHEAVK----SGINYIDTAPWYGQGRSEEVLGLAL------KDVPRESYYIATKVARYELDYDKM 113
            |.||||    :|..:||.|..|   ::|..:|.|:      |.|.||..:|.:|:      :...
Mouse    28 VREAVKVAIDAGYRHIDCAYVY---QNESEVGEAIQEKIQEKAVKREDLFIVSKL------WSTF 83

  Fly   114 FDFSAKKTRESVEKSLKLLGLDYVDVIQIHDIE-FAKDLDIVINETLPT---------------- 161
            |:.|..|  ::.:.:|..|.|||:|:..||..: |...     |..|||                
Mouse    84 FEKSLVK--KAFQNTLSDLKLDYLDLYLIHWPQGFQSG-----NVFLPTDDKGSILSSKYTFLDA 141

  Fly   162 ---LEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR---YTLTDETLLEYLDFFKS 220
               :|:||.:|..:.:|||.:....::..|.:...:...|.....   | ||.|.|::|     .
Mouse   142 WEAMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPY-LTQEKLIQY-----C 200

  Fly   221 QNLGVICAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVS 285
            .:.|:...|...||       .|..|::..:..:.           :|:.|         :.|::
Mouse   201 HSKGITITAYSPLG-------SPDRPSAKPEDPLL-----------LEIPK---------IKEIA 238

  Fly   286 TFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKENVLTKPFDWEGNE 334
            ........:.|:|.:::.|.| :..|.....| ::||:  :.||::.:|
Mouse   239 AKHKRTAAQVLIRFHIERNVV-VIPKSVTPSR-IQENI--QVFDFQLSE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 69/304 (23%)
Aldo_ket_red 24..321 CDD:294321 65/294 (22%)
Akr1b10NP_765986.3 ARA1 1..297 CDD:223729 70/309 (23%)
Tas 9..289 CDD:223739 70/309 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.