DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and Akr1c12

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_038805.2 Gene:Akr1c12 / 622402 MGIID:1351661 Length:323 Species:Mus musculus


Alignment Length:333 Identity:81/333 - (24%)
Similarity:129/333 - (38%) Gaps:69/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VSFGGGALCANYGFDL--------EEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVLGLALKD-- 91
            |....|.|....||..        .:.::....|:..|..::|||..|   :.||.:|.|::.  
Mouse     8 VKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAY---QVEEEIGQAIQSKI 69

  Fly    92 ----VPRESYYIATKV----ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVIQIH----- 143
                |.||..:|.||:    .|.||            .:.::|||||.|.|||||:..||     
Mouse    70 KAGVVKREDLFITTKLWCGCFRPEL------------VKPALEKSLKSLQLDYVDLYLIHYPVPM 122

  Fly   144 ---DIEFAKD------LDIV-INETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTV 198
               |.|...|      ||.| ..:|...||:....|..:.||||.:....|:..|.:...:...|
Mouse   123 KPGDNESPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPV 187

  Fly   199 LTYAR-YTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVC 262
            ..... :...:::.|  ||:.||:::.::     |.|.|   |.|.:....|:...:......:|
Mouse   188 CNQVECHLYLNQSKL--LDYCKSKDIVLV-----AYGAL---GTQRYKEWVDQNSPVLLNDPVLC 242

  Fly   263 -----KERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKEN 322
                 .:|...|..|...:....:|...:|     ....:|.||...|..||.::.:.|..|.:|
Mouse   243 DVAKRNKRSPALIALRYLFQRGIVPLAQSF-----KENEMRENLQVFEFQLSPEDMKTLDGLNKN 302

  Fly   323 VLTKPFDW 330
            ....|.::
Mouse   303 FRYLPAEF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 81/333 (24%)
Aldo_ket_red 24..321 CDD:294321 79/322 (25%)
Akr1c12NP_038805.2 Tas 6..297 CDD:223739 77/318 (24%)
ARA1 7..307 CDD:223729 80/328 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.