DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and kcnab1a

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_021323321.1 Gene:kcnab1a / 541540 ZFINID:ZDB-GENE-050327-79 Length:423 Species:Danio rerio


Alignment Length:353 Identity:88/353 - (24%)
Similarity:154/353 - (43%) Gaps:66/353 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MEYRNLGKTGLQVS------KVSFGGGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGR 80
            |.||||||:||:||      .|:|||     ....|:.|.:.|:  |.:||:|..|||..|..|:
Zfish    88 MPYRNLGKSGLRVSCLGLGTWVTFGG-----QISDDVAEQLMTI--AYESGVNLFDTAEVYAAGK 145

  Fly    81 SEEVLG--LALKDVPRESYYIATKV---ARYELDYDKMFDFSAKKTRESVEKSLKLLGLDYVDVI 140
            :|.:||  :..|...|.|..|.||:   .:.|.:.    ..|.|...|.::.||:.:.::||||:
Zfish   146 AEVILGNIIKKKGWRRSSLVITTKLYWGGKAETER----GLSRKHIIEGLKGSLQRMQMEYVDVV 206

  Fly   141 QIHDIEFAK--DLDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKE--FLTRTAGRLDTVLTY 201
                  ||.  |.:..:.|.:..:..::.:|.:.:.|.|.:....:.|  .:.|....:..|...
Zfish   207 ------FANRPDSNTPMEEIVRAMTYVINQGMSMYWGTSRWTAMEIMEAYSVARQFNLIPPVCEQ 265

  Fly   202 ARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLT----NAGPQ---------PW------H 245
            |.|.|  .::..::..:.:....:|.:..:..|.|::|    |..|.         .|      .
Zfish   266 AEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIITGKYENGIPDSSRASMKSYQWLKEKIVS 330

  Fly   246 PASDEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVG--- 307
            ....:|:|..::...:.::.|..|.:||:.:.:.. ..||:.|.|....:.|..||.|.:|.   
Zfish   331 EDGRKQQAKLKELGHIAEKLGCTLPQLAVAWCLRN-EGVSSVLLGTSNAEQLTENLGAIQVSKSF 394

  Fly   308 --------LSDKEQEVLRYLKENVLTKP 327
                    |..|:.|:..:::.| |:||
Zfish   395 CHVIVARDLEGKKIELSSFMEGN-LSKP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 88/353 (25%)
Aldo_ket_red 24..321 CDD:294321 83/343 (24%)
kcnab1aXP_021323321.1 Kv_beta 90..390 CDD:213602 79/317 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.