DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18547 and RGD1564865

DIOPT Version :9

Sequence 1:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001157868.1 Gene:RGD1564865 / 498789 RGDID:1564865 Length:323 Species:Rattus norvegicus


Alignment Length:307 Identity:73/307 - (23%)
Similarity:118/307 - (38%) Gaps:91/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVKSGINYIDTAPWYGQGRSEEVLGLALKD------VPRESYYIATKV----ARYELDYDKMFDF 116
            |:..|..:||:|..|   ::|:.:|.|::.      |.||..::.||:    .|.||        
  Rat    41 AIDIGFRHIDSAYVY---KNEKEVGEAIRSKITGGVVKREDIFLTTKLWSTFHRPEL-------- 94

  Fly   117 SAKKTRESVEKSLKLLGLDYVDVIQIH--------DIEFAKDLD-IVINETL------PTLEQLV 166
                .|..:|:|||...|||||:..||        :..:.||.: .::.||:      ..:|:..
  Rat    95 ----VRVGLERSLKSFQLDYVDLYLIHYPISIKPSEEIYTKDENGKILFETVDLCAIWEAMEKCK 155

  Fly   167 KEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYAR-YTLTDETLLEYLDFFKSQNLGVICAAA 230
            ..|.|:.||||.:....|:..|.:...:...|..... :...:::.|  :||.|||::.::..||
  Rat   156 DAGLAKSIGVSNFNRRQLEMILNKPGLKHRPVCNQVECHPYLNQSKL--MDFCKSQDIVLVAYAA 218

  Fly   231 HALGLLTNAGPQPW--------------------HPASDEQKAIARKASEVCKERGVELGKLAMY 275
                 |.:..|..|                    |..|..|.|:..:.     :|||.  .||..
  Rat   219 -----LGSQRPTNWVDKNAPFLLNDPVLGGMAKKHNRSPAQIALRYQV-----QRGVV--ALAQT 271

  Fly   276 YTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKEN 322
            |....:.|                |:...|..|..::.|||..|..|
  Rat   272 YEQKEMKE----------------NIQVFEFQLPSEDMEVLDGLNRN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18547NP_650138.1 Tas 22..331 CDD:223739 73/307 (24%)
Aldo_ket_red 24..321 CDD:294321 72/304 (24%)
RGD1564865NP_001157868.1 ARA1 8..311 CDD:223729 73/307 (24%)
Tas 19..297 CDD:223739 70/300 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.